PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D06G1934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 364aa    MW: 39483.9 Da    PI: 6.1137
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D06G1934genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.7e-11163221563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +  v  l++e+
  Gh_D06G1934 163 KRAKRIMANRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLFQRDVTGLTTEN 221
                  9******************************************9999988888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-17159223IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.783161224IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-11163217No hitNo description
PfamPF001701.1E-9163221IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-10163215No hitNo description
CDDcd147031.07E-24164215No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MQYPSLLNPN PLPPIPSKPN ASSTTQTALF FPNSTPFCGS HHRRAHSEVQ FRIPDELDLG  60
SDTFEGLGSE DDLFYNYVDI EKLGGSSKGP DEGGGSGSSS GGSGQNQKGE EISGGSGKGE  120
KNDGKGRHRY SNSVDGCSTM ELIEAKKAMP PDKLAELWNI DPKRAKRIMA NRQSAARSKE  180
RKARYITELE RKVQTLQTEA TTLSAQLTLF QRDVTGLTTE NTELKLRLQA MDQQARLRDA  240
LNEALKKEVE GLKIATGEAT TPTNTFNLGM HHIPYTQSSF LPPQPQHMQI DTQNIQMPPF  300
QPLQSNTLTT NPSVVGATNS YAFADMMQQD PLGQLQGLDI SSGGSHSVKS EGPSISTSES  360
SGTL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.154421e-169boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012449360.10.0PREDICTED: transcription factor RF2b-like isoform X1
SwissprotQ6S4P46e-98RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0D2UGT10.0A0A0D2UGT1_G
STRINGVIT_13s0067g02900.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.13e-96bZIP family protein